General Information

  • ID:  hor005368
  • Uniprot ID:  P67800
  • Protein name:  Diuretic hormone
  • Gene name:  NA
  • Organism:  Musca domestica (House fly)
  • Family:  Sauvagine/corticotropin-releasing factor/urotensin I family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Musca (subgenus), Musca (genus), Muscini (tribe), Muscinae (subfamily), Muscidae (family), Muscoidea (superfamily), Calyptratae, Schizophora, Cyclorrhapha, Eremoneura, Muscomorpha (infraorder), Brachycera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NKPSLSIVNPLDVLRQRLLLEIARRQMKENTRQVELNRAILKNV
  • Length:  44
  • Propeptide:  NKPSLSIVNPLDVLRQRLLLEIARRQMKENTRQVELNRAILKNV
  • Signal peptide:  NA
  • Modification:  T44 Valine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of fluid secretion. Stimulates primary urine secretion by Malpighian tubules and causes a dose-dependent stimulation of cAMP levels in the tubules. May act as clearance peptide in that it may remove metabolic waste from the hemolymph.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P67800-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P67800-F1.pdbhor005368_AF2.pdbhor005368_ESM.pdb

Physical Information

Mass: 594831 Formula: C225H397N73O64S
Absent amino acids: CFGHWY Common amino acids: L
pI: 11.91 Basic residues: 9
Polar residues: 8 Hydrophobic residues: 17
Hydrophobicity: -45.45 Boman Index: -11826
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 128.41
Instability Index: 4894.32 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  7991460
  • Title:  Isolation and characterization of a diuretic peptide common to the house fly and stable fly.